Lineage for d2v7fa1 (2v7f A:2-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694522Family a.4.5.84: Rps19E-like [158338] (1 protein)
    Pfam PF01090; local sequence similarity to members of the GntR-like family
  6. 2694523Protein Ribosomal protein S19e [158339] (1 species)
  7. 2694524Species Pyrococcus abyssi [TaxId:29292] [158340] (1 PDB entry)
    Uniprot Q9V0G8 2-150
  8. 2694525Domain d2v7fa1: 2v7f A:2-150 [152721]
    complexed with cl

Details for d2v7fa1

PDB Entry: 2v7f (more details), 1.15 Å

PDB Description: structure of p. abyssi rps19 protein
PDB Compounds: (A:) rps19e ssu ribosomal protein s19e

SCOPe Domain Sequences for d2v7fa1:

Sequence, based on SEQRES records: (download)

>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]}
atvydvpgdllvervaqrlkeipeikppewapfvktgrhkerlpeqedwwyyrvasilrr
vyldgpvgierlrtyyggrknrghaperfykaggsiirkalqqleaagfvekvpgkgrvi
tpkgrsfldkiatelkkeleeiipelkky

Sequence, based on observed residues (ATOM records): (download)

>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]}
atvydvpgdllvervaqrlkeipeikppewapfvktlpeqedwwyyrvasilrrvyldgp
vgierlrtyyggghaperfykaggsiirkalqqleaagfvekvpgkgrvitpkgrsfldk
iatelkkeleeiipelkky

SCOPe Domain Coordinates for d2v7fa1:

Click to download the PDB-style file with coordinates for d2v7fa1.
(The format of our PDB-style files is described here.)

Timeline for d2v7fa1: