Lineage for d2v7dc_ (2v7d C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007267Protein automated matches [190238] (9 species)
    not a true protein
  7. 2007268Species Cow (Bos taurus) [TaxId:9913] [187212] (1 PDB entry)
  8. 2007271Domain d2v7dc_: 2v7d C: [152719]
    automated match to d1qjba_

Details for d2v7dc_

PDB Entry: 2v7d (more details), 2.5 Å

PDB Description: 14-3-3 protein zeta in complex with thr758 phosphorylated integrin beta2 peptide
PDB Compounds: (C:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d2v7dc_:

Sequence, based on SEQRES records: (download)

>d2v7dc_ a.118.7.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d2v7dc_ a.118.7.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
wrvvssieqktekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtleesykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d2v7dc_:

Click to download the PDB-style file with coordinates for d2v7dc_.
(The format of our PDB-style files is described here.)

Timeline for d2v7dc_: