Lineage for d2v7db_ (2v7d B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333688Species Cow (Bos taurus) [TaxId:9913] [187212] (1 PDB entry)
  8. 2333690Domain d2v7db_: 2v7d B: [152718]
    automated match to d1qjba_

Details for d2v7db_

PDB Entry: 2v7d (more details), 2.5 Å

PDB Description: 14-3-3 protein zeta in complex with thr758 phosphorylated integrin beta2 peptide
PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d2v7db_:

Sequence, based on SEQRES records: (download)

>d2v7db_ a.118.7.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d2v7db_ a.118.7.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
wrvvssieqkteekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlesykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d2v7db_:

Click to download the PDB-style file with coordinates for d2v7db_.
(The format of our PDB-style files is described here.)

Timeline for d2v7db_: