![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() automatically mapped to Pfam PF00244 |
![]() | Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
![]() | Protein automated matches [190238] (11 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187212] (1 PDB entry) |
![]() | Domain d2v7da_: 2v7d A: [152717] automated match to d1qjba_ |
PDB Entry: 2v7d (more details), 2.5 Å
SCOPe Domain Sequences for d2v7da_:
Sequence, based on SEQRES records: (download)
>d2v7da_ a.118.7.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
>d2v7da_ a.118.7.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss wrvvssieqkaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d2v7da_: