SCOPe 2.06: Domain d2v6na_: 2v6n A:

Lineage for d2v6na_ (2v6n A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)

8. Domain d2v6na_: 2v6n A: [152716]
   automated match to d1uj1b_
   complexed with mes, so4, xp1

Details for d2v6na_

PDB Entry: 2v6n, 1.98 Å

PDB Description: crystal structures of the sars-coronavirus main proteinase inactivated by benzotriazole compounds

PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2v6na_:

Sequence; same for both SEQRES and ATOM records:

>d2v6na_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

Timeline for d2v6na_:

• d2v6na_ first appeared in SCOP 1.75, called d2v6na1
  
• d2v6na_ appears in SCOPe 2.05
  
• d2v6na_ appears in SCOPe 2.07
  
• d2v6na_ appears in the current release, SCOPe 2.08