Lineage for d2v6ak_ (2v6a K:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031357Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1031358Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1031359Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1031517Protein automated matches [190066] (1 species)
    not a true protein
  7. 1031518Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1031521Domain d2v6ak_: 2v6a K: [152710]
    Other proteins in same PDB: d2v6aa1, d2v6aa2, d2v6ab1, d2v6ab2, d2v6ac1, d2v6ac2, d2v6ad1, d2v6ad2, d2v6ae1, d2v6ae2, d2v6af1, d2v6af2, d2v6ag1, d2v6ag2, d2v6ah1, d2v6ah2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d2v6ak_

PDB Entry: 2v6a (more details), 1.5 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
PDB Compounds: (K:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v6ak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v6ak_ d.73.1.1 (K:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2v6ak_:

Click to download the PDB-style file with coordinates for d2v6ak_.
(The format of our PDB-style files is described here.)

Timeline for d2v6ak_: