![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein automated matches [190066] (7 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries) |
![]() | Domain d2v6ai_: 2v6a I: [152708] Other proteins in same PDB: d2v6aa1, d2v6aa2, d2v6ab1, d2v6ab2, d2v6ac1, d2v6ac2, d2v6ad1, d2v6ad2, d2v6ae1, d2v6ae2, d2v6af1, d2v6af2, d2v6ag1, d2v6ag2, d2v6ah1, d2v6ah2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 2v6a (more details), 1.5 Å
SCOPe Domain Sequences for d2v6ai_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v6ai_ d.73.1.1 (I:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpktardfqpankrsv
Timeline for d2v6ai_: