Lineage for d2v6ag2 (2v6a G:11-149)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909408Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 1909415Domain d2v6ag2: 2v6a G:11-149 [152705]
    Other proteins in same PDB: d2v6aa1, d2v6ab1, d2v6ac1, d2v6ad1, d2v6ae1, d2v6af1, d2v6ag1, d2v6ah1, d2v6ai_, d2v6aj_, d2v6ak_, d2v6al_, d2v6am_, d2v6an_, d2v6ao_, d2v6ap_
    automated match to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d2v6ag2

PDB Entry: 2v6a (more details), 1.5 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v6ag2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v6ag2 d.58.9.0 (G:11-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOPe Domain Coordinates for d2v6ag2:

Click to download the PDB-style file with coordinates for d2v6ag2.
(The format of our PDB-style files is described here.)

Timeline for d2v6ag2: