Lineage for d2v6ag1 (2v6a G:150-475)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824891Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1824892Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1825087Protein automated matches [226984] (5 species)
    not a true protein
  7. 1825088Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 1825095Domain d2v6ag1: 2v6a G:150-475 [152704]
    Other proteins in same PDB: d2v6aa2, d2v6ab2, d2v6ac2, d2v6ad2, d2v6ae2, d2v6af2, d2v6ag2, d2v6ah2, d2v6ai_, d2v6aj_, d2v6ak_, d2v6al_, d2v6am_, d2v6an_, d2v6ao_, d2v6ap_
    automated match to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d2v6ag1

PDB Entry: 2v6a (more details), 1.5 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v6ag1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v6ag1 c.1.14.1 (G:150-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tavgklegerevtlsfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d2v6ag1:

Click to download the PDB-style file with coordinates for d2v6ag1.
(The format of our PDB-style files is described here.)

Timeline for d2v6ag1: