| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
| Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries) |
| Domain d2v6ad2: 2v6a D:10-149 [152699] Other proteins in same PDB: d2v6aa1, d2v6ab1, d2v6ac1, d2v6ad1, d2v6ae1, d2v6af1, d2v6ag1, d2v6ah1, d2v6ai1, d2v6aj1, d2v6ak1, d2v6al1, d2v6am1, d2v6an1, d2v6ao1, d2v6ap1 automatically matched to d1gk8a2 complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v6a (more details), 1.5 Å
SCOP Domain Sequences for d2v6ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v6ad2 d.58.9.1 (D:10-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
lralrledlrippayvktfv
Timeline for d2v6ad2: