Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries) |
Domain d2v69p1: 2v69 P:2-140 [152691] Other proteins in same PDB: d2v69a1, d2v69a2, d2v69b1, d2v69b2, d2v69c1, d2v69c2, d2v69d1, d2v69d2, d2v69e1, d2v69e2, d2v69f1, d2v69f2, d2v69g1, d2v69g2, d2v69h1, d2v69h2 automatically matched to d1ir21_ complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v69 (more details), 2.8 Å
SCOP Domain Sequences for d2v69p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v69p1 d.73.1.1 (P:2-140) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf lvqrpktardfqpankrsv
Timeline for d2v69p1: