Lineage for d2v69m_ (2v69 M:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913367Protein automated matches [190066] (5 species)
    not a true protein
  7. 1913368Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1913421Domain d2v69m_: 2v69 M: [152688]
    Other proteins in same PDB: d2v69a1, d2v69a2, d2v69b1, d2v69b2, d2v69c1, d2v69c2, d2v69d1, d2v69d2, d2v69e1, d2v69e2, d2v69f1, d2v69f2, d2v69g1, d2v69g2, d2v69h1, d2v69h2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d2v69m_

PDB Entry: 2v69 (more details), 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e
PDB Compounds: (M:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v69m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v69m_ d.73.1.1 (M:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2v69m_:

Click to download the PDB-style file with coordinates for d2v69m_.
(The format of our PDB-style files is described here.)

Timeline for d2v69m_: