SCOP 1.73: Domain d1qi8c_: 1qi8 C:

Lineage for d1qi8c_ (1qi8 C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)

8. Domain d1qi8c_: 1qi8 C: [15264]
   Other proteins in same PDB: d1qi8b_, d1qi8d_
   complexed with hem; mutant

Details for d1qi8c_

PDB Entry: 1qi8, 1.8 Å

PDB Description: deoxygenated structure of a distal pocket hemoglobin mutant

PDB Compounds: (C:) hemoglobin

SCOP Domain Sequences for d1qi8c_:

Sequence; same for both SEQRES and ATOM records:

>d1qi8c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1qi8c_:

• d1qi8c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qi8c_ appears in SCOP 1.71
  
• d1qi8c_ appears in SCOP 1.75
  
• d1qi8c_ appears in the current release, SCOPe 2.08