| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
| Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries) |
| Domain d2v67l1: 2v67 L:2-140 [152639] Other proteins in same PDB: d2v67a1, d2v67a2, d2v67b1, d2v67b2, d2v67c1, d2v67c2, d2v67d1, d2v67d2, d2v67e1, d2v67e2, d2v67f1, d2v67f2, d2v67g1, d2v67g2, d2v67h1, d2v67h2 automatically matched to d1ir21_ complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v67 (more details), 2 Å
SCOP Domain Sequences for d2v67l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v67l1 d.73.1.1 (L:2-140) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrpktardfqpankrsv
Timeline for d2v67l1: