Lineage for d2v67h1 (2v67 H:150-475)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818439Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 818440Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 818441Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 818466Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (11 PDB entries)
  8. 818510Domain d2v67h1: 2v67 H:150-475 [152634]
    Other proteins in same PDB: d2v67a2, d2v67b2, d2v67c2, d2v67d2, d2v67e2, d2v67f2, d2v67g2, d2v67h2, d2v67i1, d2v67j1, d2v67k1, d2v67l1, d2v67m1, d2v67n1, d2v67o1, d2v67p1
    automatically matched to d1gk8a1
    complexed with cap, edo, mg, mme; mutant

Details for d2v67h1

PDB Entry: 2v67 (more details), 2 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v67h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v67h1 c.1.14.1 (H:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevilgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOP Domain Coordinates for d2v67h1:

Click to download the PDB-style file with coordinates for d2v67h1.
(The format of our PDB-style files is described here.)

Timeline for d2v67h1: