| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (18 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
| Domain d2v67b2: 2v67 B:9-149 [152623] Other proteins in same PDB: d2v67a1, d2v67b1, d2v67c1, d2v67d1, d2v67e1, d2v67f1, d2v67g1, d2v67h1, d2v67i_, d2v67j_, d2v67k_, d2v67l_, d2v67m_, d2v67n_, d2v67o_, d2v67p_ automated match to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 2v67 (more details), 2 Å
SCOPe Domain Sequences for d2v67b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v67b2 d.58.9.0 (B:9-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv
Timeline for d2v67b2: