| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46487] (287 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
| Domain d1c7ca1: 1c7c A:1-142 [15261] Other proteins in same PDB: d1c7cb_, d1c7cd_ recombinant hemoglobin rhb1.1 complexed with hem |
PDB Entry: 1c7c (more details), 1.8 Å
SCOPe Domain Sequences for d1c7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ca1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg
Timeline for d1c7ca1: