SCOP 1.57: Domain d1c7ca1: 1c7c A:1-142

Lineage for d1c7ca1 (1c7c A:1-142)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (14 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (73 PDB entries)

8. Domain d1c7ca1: 1c7c A:1-142 [15261]
   Other proteins in same PDB: d1c7cb_, d1c7cd_

Details for d1c7ca1

PDB Entry: 1c7c, 1.8 Å

PDB Description: deoxy rhb1.1 (recombinant hemoglobin)

SCOP Domain Sequences for d1c7ca1:

Sequence; same for both SEQRES and ATOM records:

>d1c7ca1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

Timeline for d1c7ca1:

• d1c7ca1 first appeared (with stable ids) in SCOP 1.55
  
• d1c7ca1 appears in SCOP 1.59
  
• d1c7ca1 appears in the current release, SCOPe 2.08