| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (12 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
| Domain d2v63h2: 2v63 H:9-149 [152608] Other proteins in same PDB: d2v63a1, d2v63b1, d2v63c1, d2v63d1, d2v63e1, d2v63f1, d2v63g1, d2v63h1, d2v63i_, d2v63j_, d2v63k_, d2v63l_, d2v63m_, d2v63n_, d2v63o_, d2v63p_ automated match to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 2v63 (more details), 1.8 Å
SCOPe Domain Sequences for d2v63h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v63h2 d.58.9.0 (H:9-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv
Timeline for d2v63h2: