Lineage for d2v63b2 (2v63 B:9-149)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909408Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 1909418Domain d2v63b2: 2v63 B:9-149 [152596]
    Other proteins in same PDB: d2v63a1, d2v63b1, d2v63c1, d2v63d1, d2v63e1, d2v63f1, d2v63g1, d2v63h1, d2v63i_, d2v63j_, d2v63k_, d2v63l_, d2v63m_, d2v63n_, d2v63o_, d2v63p_
    automated match to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d2v63b2

PDB Entry: 2v63 (more details), 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v63b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v63b2 d.58.9.0 (B:9-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv

SCOPe Domain Coordinates for d2v63b2:

Click to download the PDB-style file with coordinates for d2v63b2.
(The format of our PDB-style files is described here.)

Timeline for d2v63b2: