Lineage for d2v63b1 (2v63 B:150-474)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088660Protein automated matches [226984] (9 species)
    not a true protein
  7. 2088661Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 2088687Domain d2v63b1: 2v63 B:150-474 [152595]
    Other proteins in same PDB: d2v63a2, d2v63b2, d2v63c2, d2v63d2, d2v63e2, d2v63f2, d2v63g2, d2v63h2, d2v63i_, d2v63j_, d2v63k_, d2v63l_, d2v63m_, d2v63n_, d2v63o_, d2v63p_
    automated match to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d2v63b1

PDB Entry: 2v63 (more details), 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v63b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v63b1 c.1.14.1 (B:150-474) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tavgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidk

SCOPe Domain Coordinates for d2v63b1:

Click to download the PDB-style file with coordinates for d2v63b1.
(The format of our PDB-style files is described here.)

Timeline for d2v63b1: