Lineage for d2v60a2 (2v60 A:290-401)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404207Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1404208Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1404418Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 1404452Protein Monoamine oxidase B [69673] (2 species)
  7. 1404453Species Human (Homo sapiens) [TaxId:9606] [69674] (37 PDB entries)
  8. 1404488Domain d2v60a2: 2v60 A:290-401 [152586]
    Other proteins in same PDB: d2v60a1, d2v60b1
    automated match to d1s3ea2
    complexed with c17, fad

Details for d2v60a2

PDB Entry: 2v60 (more details), 2 Å

PDB Description: structure of human mao b in complex with the selective inhibitor 7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin
PDB Compounds: (A:) amine oxidase (flavin-containing) b

SCOPe Domain Sequences for d2v60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v60a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d2v60a2:

Click to download the PDB-style file with coordinates for d2v60a2.
(The format of our PDB-style files is described here.)

Timeline for d2v60a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v60a1