SCOPe 2.07: Domain d2v5qc1: 2v5q C:13-137

Lineage for d2v5qc1 (2v5q C:13-137)

1. Root: SCOPe 2.07

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)

4. Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family)

5. Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)

6. Protein 4ank [83024] (2 species)

7. Species unidentified [TaxId:32644] [161333] (1 PDB entry)

8. Domain d2v5qc1: 2v5q C:13-137 [152580]
   Other proteins in same PDB: d2v5qc2
   automatically matched to d1n0ra_

Details for d2v5qc1

PDB Entry: 2v5q, 2.3 Å

PDB Description: crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin

PDB Compounds: (C:) design ankyrin repeat protein

SCOPe Domain Sequences for d2v5qc1:

Sequence; same for both SEQRES and ATOM records:

>d2v5qc1 k.37.1.1 (C:13-137) 4ank {unidentified [TaxId: 32644]}
dlgkklleaaragqddevriliangadvnavdntgltplhlaavsghleivevllkhgad
vdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivevl
lkyga

Timeline for d2v5qc1:

• d2v5qc1 first appeared in SCOP 1.75
  
• d2v5qc1 appears in SCOPe 2.06
  
• d2v5qc1 appears in the current release, SCOPe 2.08