Class k: Designed proteins [58788] (44 folds) |
Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily) |
Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) |
Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins) |
Protein 4ank [83024] (2 species) |
Species unidentified [TaxId:32644] [161333] (1 PDB entry) |
Domain d2v5qc1: 2v5q C:13-137 [152580] Other proteins in same PDB: d2v5qc2 automatically matched to d1n0ra_ |
PDB Entry: 2v5q (more details), 2.3 Å
SCOPe Domain Sequences for d2v5qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5qc1 k.37.1.1 (C:13-137) 4ank {unidentified [TaxId: 32644]} dlgkklleaaragqddevriliangadvnavdntgltplhlaavsghleivevllkhgad vdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivevl lkyga
Timeline for d2v5qc1: