Lineage for d2v5qc1 (2v5q C:21-137)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901610Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 901611Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 901612Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 901625Protein 4ank [83024] (2 species)
  7. 901628Species unidentified [TaxId:32644] [161333] (1 PDB entry)
  8. 901629Domain d2v5qc1: 2v5q C:21-137 [152580]
    automatically matched to d1n0ra_

Details for d2v5qc1

PDB Entry: 2v5q (more details), 2.3 Å

PDB Description: crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
PDB Compounds: (C:) design ankyrin repeat protein

SCOP Domain Sequences for d2v5qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5qc1 k.37.1.1 (C:21-137) 4ank {unidentified [TaxId: 32644]}
aaragqddevriliangadvnavdntgltplhlaavsghleivevllkhgadvdaadvyg
ftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivevllkyga

SCOP Domain Coordinates for d2v5qc1:

Click to download the PDB-style file with coordinates for d2v5qc1.
(The format of our PDB-style files is described here.)

Timeline for d2v5qc1: