Lineage for d2v5qc1 (2v5q C:13-137)

  1. Root: SCOPe 2.07
  2. 2598153Class k: Designed proteins [58788] (44 folds)
  3. 2598669Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 2598670Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 2598671Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 2598678Protein 4ank [83024] (2 species)
  7. 2598681Species unidentified [TaxId:32644] [161333] (1 PDB entry)
  8. 2598682Domain d2v5qc1: 2v5q C:13-137 [152580]
    Other proteins in same PDB: d2v5qc2
    automatically matched to d1n0ra_

Details for d2v5qc1

PDB Entry: 2v5q (more details), 2.3 Å

PDB Description: crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
PDB Compounds: (C:) design ankyrin repeat protein

SCOPe Domain Sequences for d2v5qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5qc1 k.37.1.1 (C:13-137) 4ank {unidentified [TaxId: 32644]}
dlgkklleaaragqddevriliangadvnavdntgltplhlaavsghleivevllkhgad
vdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivevl
lkyga

SCOPe Domain Coordinates for d2v5qc1:

Click to download the PDB-style file with coordinates for d2v5qc1.
(The format of our PDB-style files is described here.)

Timeline for d2v5qc1: