SCOPe 2.06: Domain d2v5pc1: 2v5p C:6-63

Lineage for d2v5pc1 (2v5p C:6-63)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (22 PDB entries)
   Uniprot P05019 49-110

8. Domain d2v5pc1: 2v5p C:6-63 [152578]
   automatically matched to d1igla_
   complexed with nag

Details for d2v5pc1

PDB Entry: 2v5p, 4.1 Å

PDB Description: complex structure of human igf2r domains 11-13 bound to igf-ii

PDB Compounds: (C:) insulin-like growth factor II

SCOPe Domain Sequences for d2v5pc1:

Sequence, based on SEQRES records:

>d2v5pc1 g.1.1.1 (C:6-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatp

Sequence, based on observed residues (ATOM records):

>d2v5pc1 g.1.1.1 (C:6-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp

Timeline for d2v5pc1:

• d2v5pc1 first appeared in SCOP 1.75
  
• d2v5pc1 appears in SCOPe 2.05
  
• d2v5pc1 appears in SCOPe 2.07
  
• d2v5pc1 appears in the current release, SCOPe 2.08