![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (5 proteins) |
![]() | Protein Insulin-like growth factor [57002] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries) Uniprot P05019 49-110 |
![]() | Domain d2v5pc1: 2v5p C:6-63 [152578] automatically matched to d1igla_ complexed with nag |
PDB Entry: 2v5p (more details), 4.1 Å
SCOPe Domain Sequences for d2v5pc1:
Sequence, based on SEQRES records: (download)
>d2v5pc1 g.1.1.1 (C:6-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} etlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatp
>d2v5pc1 g.1.1.1 (C:6-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp
Timeline for d2v5pc1: