Lineage for d2v5pc1 (2v5p C:6-63)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1458802Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1458803Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1458804Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1459024Protein Insulin-like growth factor [57002] (1 species)
  7. 1459025Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
    Uniprot P05019 49-110
  8. 1459037Domain d2v5pc1: 2v5p C:6-63 [152578]
    automatically matched to d1igla_
    complexed with nag

Details for d2v5pc1

PDB Entry: 2v5p (more details), 4.1 Å

PDB Description: complex structure of human igf2r domains 11-13 bound to igf-ii
PDB Compounds: (C:) insulin-like growth factor II

SCOPe Domain Sequences for d2v5pc1:

Sequence, based on SEQRES records: (download)

>d2v5pc1 g.1.1.1 (C:6-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatp

Sequence, based on observed residues (ATOM records): (download)

>d2v5pc1 g.1.1.1 (C:6-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp

SCOPe Domain Coordinates for d2v5pc1:

Click to download the PDB-style file with coordinates for d2v5pc1.
(The format of our PDB-style files is described here.)

Timeline for d2v5pc1: