Lineage for d2v5la_ (2v5l A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1565958Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1565959Protein Triosephosphate isomerase [51353] (20 species)
  7. 1566167Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1566234Domain d2v5la_: 2v5l A: [152576]
    automated match to d1tpfa_
    complexed with so4

Details for d2v5la_

PDB Entry: 2v5l (more details), 2.4 Å

PDB Description: structures of the open and closed state of trypanosomal triosephosphate isomerase: as observed in a new crystal form: implications for the reaction mechanism
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d2v5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5la_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOPe Domain Coordinates for d2v5la_:

Click to download the PDB-style file with coordinates for d2v5la_.
(The format of our PDB-style files is described here.)

Timeline for d2v5la_: