Lineage for d2v5la1 (2v5l A:2-250)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814175Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 814176Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 814177Protein Triosephosphate isomerase [51353] (18 species)
  7. 814315Species Trypanosoma (Trypanozoon) brucei brucei (Trypanosoma brucei brucei) [TaxId:39700] [159375] (1 PDB entry)
  8. 814316Domain d2v5la1: 2v5l A:2-250 [152576]
    automatically matched to d1tpfa_
    complexed with so4

Details for d2v5la1

PDB Entry: 2v5l (more details), 2.4 Å

PDB Description: structures of the open and closed state of trypanosomal triosephosphate isomerase: as observed in a new crystal form: implications for the reaction mechanism
PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d2v5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5la1 c.1.1.1 (A:2-250) Triosephosphate isomerase {Trypanosoma (Trypanozoon) brucei brucei (Trypanosoma brucei brucei) [TaxId: 39700]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOP Domain Coordinates for d2v5la1:

Click to download the PDB-style file with coordinates for d2v5la1.
(The format of our PDB-style files is described here.)

Timeline for d2v5la1: