Lineage for d2v4yf_ (2v4y F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905248Protein automated matches [190400] (4 species)
    not a true protein
  7. 2905249Species Escherichia coli K-12 [TaxId:83333] [187271] (3 PDB entries)
  8. 2905259Domain d2v4yf_: 2v4y F: [152575]
    automated match to d2bnea1
    complexed with gtp

Details for d2v4yf_

PDB Entry: 2v4y (more details), 2.8 Å

PDB Description: the structure of e. coli ump kinase in complex with its allosteric regulator gtp
PDB Compounds: (F:) uridylate kinase

SCOPe Domain Sequences for d2v4yf_:

Sequence, based on SEQRES records: (download)

>d2v4yf_ c.73.1.3 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Sequence, based on observed residues (ATOM records): (download)

>d2v4yf_ c.73.1.3 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftkdptatmyeqlt
ysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

SCOPe Domain Coordinates for d2v4yf_:

Click to download the PDB-style file with coordinates for d2v4yf_.
(The format of our PDB-style files is described here.)

Timeline for d2v4yf_: