SCOPe 2.05: Domain d2v4ye_: 2v4y E:

Lineage for d2v4ye_ (2v4y E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187271] (3 PDB entries)

8. Domain d2v4ye_: 2v4y E: [152574]
   automated match to d2bnea1
   complexed with gtp

Details for d2v4ye_

PDB Entry: 2v4y, 2.8 Å

PDB Description: the structure of e. coli ump kinase in complex with its allosteric regulator gtp

PDB Compounds: (E:) uridylate kinase

SCOPe Domain Sequences for d2v4ye_:

Sequence, based on SEQRES records:

>d2v4ye_ c.73.1.3 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Sequence, based on observed residues (ATOM records):

>d2v4ye_ c.73.1.3 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpadptatmye
qltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Timeline for d2v4ye_:

• d2v4ye_ first appeared in SCOP 1.75, called d2v4ye1
  
• d2v4ye_ appears in SCOPe 2.04
  
• d2v4ye_ appears in SCOPe 2.06
  
• d2v4ye_ appears in the current release, SCOPe 2.08