Lineage for d2v4jb1 (2v4j B:209-277)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192801Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2192859Protein DsrB insert domain [160277] (2 species)
  7. 2192879Species Desulfovibrio vulgaris [TaxId:881] [160278] (1 PDB entry)
    Uniprot P45575 209-277
  8. 2192880Domain d2v4jb1: 2v4j B:209-277 [152559]
    Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je2, d2v4je3, d2v4jf_
    complexed with sf4, sh0, so3, srm

Details for d2v4jb1

PDB Entry: 2v4j (more details), 2.1 Å

PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d2v4jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]}
kppmidhewtdqlceiplavascptaavrptkleigdkkvntiaiknercmycgncytmc
palpisdge

SCOPe Domain Coordinates for d2v4jb1:

Click to download the PDB-style file with coordinates for d2v4jb1.
(The format of our PDB-style files is described here.)

Timeline for d2v4jb1: