Domain d2v4jb1: 2v4j B:209-277

Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)

Lineage for d2v4jb1 (2v4j B:209-277)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 protein domains)
members of this "family" may be more closely related to other ferredoxins than to each other
Protein DsrB insert domain [160277] (2 species)
Species Desulfovibrio vulgaris [TaxId:881] [160278] (1 PDB entry)
Uniprot P45575 209-277

Domain d2v4jb1: 2v4j B:209-277 [152559]
Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je2, d2v4je3, d2v4jf1
complexed with sf4, so3, srm

PDB Entry: 2v4j (more details)
PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOP Domain Sequences for d2v4jb1:
Sequence; same for both SEQRES and ATOM records: (download)

>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} kppmidhewtdqlceiplavascptaavrptkleigdkkvntiaiknercmycgncytmc palpisdge

SCOP Domain Coordinates for d2v4jb1:

Click to download the PDB-style file with coordinates for d2v4jb1.
(The format of our PDB-style files is described here.)

Timeline for d2v4jb1:
d2v4jb1 is new in SCOP 1.75
d2v4jb1 appears in SCOP 1.75A

d2v4jb1
(click for larger image)

d2v4jb1 in context of chain
Domains from same chain:
d2v4jb2, d2v4jb3

d2v4jb1 in context of PDB
Domains from other chains:
d2v4ja1, d2v4ja2, d2v4ja3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf1