Lineage for d2v4ja3 (2v4j A:168-241,A:323-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216529Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2216530Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2216531Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2216532Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species)
  7. 2216550Species Desulfovibrio vulgaris [TaxId:881] [160778] (1 PDB entry)
    Uniprot P45574 168-241,323-437
  8. 2216551Domain d2v4ja3: 2v4j A:168-241,A:323-437 [152558]
    Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4je1, d2v4je2, d2v4je3, d2v4jf_
    complexed with sf4, sh0, so3, srm

Details for d2v4ja3

PDB Entry: 2v4j (more details), 2.1 Å

PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d2v4ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4ja3 d.134.1.1 (A:168-241,A:323-437) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]}
gsnlrtpesclgksrcefacydsqaacyeltmeyqdelhrpafpykfkfkfdacpngcva
siarsdfsvigtwkXrgasilcgakapildgaqmgsllvpfvaaeepfdeikevvekiwd
wwmeegknrerlgetmkrlsfqkllevteiapvpqhvkeprtnpyiffkeeevpggwdrd
iteyrkrhlr

SCOPe Domain Coordinates for d2v4ja3:

Click to download the PDB-style file with coordinates for d2v4ja3.
(The format of our PDB-style files is described here.)

Timeline for d2v4ja3: