Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein DsrA insert domain [160280] (2 species) |
Species Desulfovibrio vulgaris [TaxId:881] [160281] (1 PDB entry) Uniprot P45574 242-322 |
Domain d2v4ja1: 2v4j A:242-322 [152556] Other proteins in same PDB: d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf_ complexed with sf4, sh0, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4ja1 d.58.1.5 (A:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]} ddikidaeavkayvagefkpnagahsgrdwgkfdieaevvnrcpskcmkwdgsklsidnk ecvrcmhcintmpralhigde
Timeline for d2v4ja1: