Lineage for d2v4961 (2v49 6:9-53)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1706394Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1706595Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 1706596Protein Ribosomal protein L33p [144204] (3 species)
  7. 1706614Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
    Uniprot P35871 8-52
  8. 1706620Domain d2v4961: 2v49 6:9-53 [152543]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1
    automatically matched to 2J01 6:9-53

Details for d2v4961

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (6:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2v4961:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4961 g.41.8.6 (6:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk

SCOPe Domain Coordinates for d2v4961:

Click to download the PDB-style file with coordinates for d2v4961.
(The format of our PDB-style files is described here.)

Timeline for d2v4961: