![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.325: L28p-like [143799] (1 superfamily) unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715) |
![]() | Superfamily d.325.1: L28p-like [143800] (2 families) ![]() In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known |
![]() | Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein) Pfam PF01197 |
![]() | Protein Ribosomal protein L31p [143805] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [160711] (7 PDB entries) Uniprot Q5SJE1 1-50 |
![]() | Domain d2v4941: 2v49 4:1-50 [152541] Other proteins in same PDB: d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1 automatically matched to 2J01 4:1-50 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOPe Domain Sequences for d2v4941:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4941 d.325.1.2 (4:1-50) Ribosomal protein L31p {Thermus thermophilus [TaxId: 274]} mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfv
Timeline for d2v4941: