Lineage for d2v48y1 (2v48 Y:1-185)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912596Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912641Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 1912642Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1912643Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1912659Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)
  8. 1912664Domain d2v48y1: 2v48 Y:1-185 [152540]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v48y1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (Y:) ribosome recycling factor

SCOPe Domain Sequences for d2v48y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48y1 d.67.3.1 (Y:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

SCOPe Domain Coordinates for d2v48y1:

Click to download the PDB-style file with coordinates for d2v48y1.
(The format of our PDB-style files is described here.)

Timeline for d2v48y1: