SCOPe 2.06: Domain d2v48n1: 2v48 N:2-61

Lineage for d2v48n1 (2v48 N:2-61)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2v48n1: 2v48 N:2-61 [152532]
   Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
   complexed with mg, zn
   complexed with mg, zn

Details for d2v48n1

PDB Entry: 2v48, 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2v48n1:

Sequence; same for both SEQRES and ATOM records:

>d2v48n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2v48n1:

• d2v48n1 first appeared in SCOP 1.75
  
• d2v48n1 appears in SCOPe 2.05
  
• d2v48n1 appears in SCOPe 2.07
  
• d2v48n1 appears in the current release, SCOPe 2.08