Lineage for d2v48m1 (2v48 M:2-126)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507114Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1507115Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1507116Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 1507117Protein Ribosomal protein S13 [46948] (2 species)
  7. 1507145Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 1507173Domain d2v48m1: 2v48 M:2-126 [152531]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
    automatically matched to d1fjgm_
    complexed with mg, zn

Details for d2v48m1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2v48m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48m1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOPe Domain Coordinates for d2v48m1:

Click to download the PDB-style file with coordinates for d2v48m1.
(The format of our PDB-style files is described here.)

Timeline for d2v48m1: