Lineage for d2v48g1 (2v48 G:2-156)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495946Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1495947Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1495948Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1495949Protein Ribosomal protein S7 [47975] (4 species)
  7. 1495979Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1496010Domain d2v48g1: 2v48 G:2-156 [152525]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
    automatically matched to d1fjgg_
    complexed with mg, zn

Details for d2v48g1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2v48g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48g1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2v48g1:

Click to download the PDB-style file with coordinates for d2v48g1.
(The format of our PDB-style files is described here.)

Timeline for d2v48g1: