Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.3: Small subunit [58132] (3 proteins) |
Protein Prokaryotic (30S subunit) [58133] (1 species) |
Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
Domain d2v48e1: 2v48 E:5-154 [152523] Other proteins in same PDB: d2v48b1, d2v48d1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v48 (more details), 3.8 Å
SCOPe Domain Sequences for d2v48e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v48e1 i.1.1.3 (E:5-154) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg srnpiniayatmealrqlrtkadverlrkg
Timeline for d2v48e1: