Lineage for d2v48e1 (2v48 E:5-154)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711644Family i.1.1.3: Small subunit [58132] (2 proteins)
  6. 1711645Protein 30S subunit [58133] (1 species)
  7. 1711646Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1711653Domain d2v48e1: 2v48 E:5-154 [152523]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
    automatically matched to d1fkae_
    complexed with mg, zn

Details for d2v48e1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2v48e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48e1 i.1.1.3 (E:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2v48e1:

Click to download the PDB-style file with coordinates for d2v48e1.
(The format of our PDB-style files is described here.)

Timeline for d2v48e1: