Lineage for d2v47z1 (2v47 Z:3-179)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323258Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 1323259Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 1323260Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 1323295Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 1323303Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 1323310Domain d2v47z1: 2v47 Z:3-179 [152520]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1
    automatically matched to 2J01 Z:3-179

Details for d2v47z1

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (Z:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2v47z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v47z1 b.53.1.1 (Z:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d2v47z1:

Click to download the PDB-style file with coordinates for d2v47z1.
(The format of our PDB-style files is described here.)

Timeline for d2v47z1: