![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() automatically mapped to Pfam PF00829 |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
![]() | Domain d2v47v1: 2v47 V:1-101 [152518] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47y1, d2v47z1 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d2v47v1: