Lineage for d2v47u1 (2v47 U:2-118)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347885Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2347926Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2347927Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2347928Protein Ribosomal protein L20 [74733] (4 species)
  7. 2347968Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 2347973Domain d2v47u1: 2v47 U:2-118 [152517]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47v1, d2v47y1, d2v47z1

Details for d2v47u1

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (U:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2v47u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v47u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOPe Domain Coordinates for d2v47u1:

Click to download the PDB-style file with coordinates for d2v47u1.
(The format of our PDB-style files is described here.)

Timeline for d2v47u1: