Class a: All alpha proteins [46456] (285 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) automatically mapped to Pfam PF00453 |
Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
Protein Ribosomal protein L20 [74733] (4 species) |
Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries) Uniprot P60491 1-117 |
Domain d2v47u1: 2v47 U:2-118 [152517] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 U:2-118 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
Timeline for d2v47u1: