Lineage for d2v47n1 (2v47 N:1-139)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355845Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 1355846Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 1355847Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 1355848Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 1355929Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
    Uniprot P60488 1-139
  8. 1355934Domain d2v47n1: 2v47 N:1-139 [152514]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1
    automatically matched to 2J01 N:1-139

Details for d2v47n1

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (N:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2v47n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v47n1 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
kvyagpdhphqaqrpekle

SCOPe Domain Coordinates for d2v47n1:

Click to download the PDB-style file with coordinates for d2v47n1.
(The format of our PDB-style files is described here.)

Timeline for d2v47n1: