Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries) Uniprot P60488 1-139 |
Domain d2v47n1: 2v47 N:1-139 [152514] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 N:1-139 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47n1 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl kvyagpdhphqaqrpekle
Timeline for d2v47n1: