Lineage for d2v47h2 (2v47 H:83-171)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928241Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1928242Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 1928243Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1928244Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1928399Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 1928409Domain d2v47h2: 2v47 H:83-171 [152513]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1

Details for d2v47h2

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2v47h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v47h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

SCOPe Domain Coordinates for d2v47h2:

Click to download the PDB-style file with coordinates for d2v47h2.
(The format of our PDB-style files is described here.)

Timeline for d2v47h2: