![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() automatically mapped to Pfam PF00573 |
![]() | Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
![]() | Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
![]() | Species Thermus thermophilus [TaxId:274] [159476] (11 PDB entries) Uniprot Q5SHN9 1-208 |
![]() | Domain d2v47f1: 2v47 F:1-208 [152511] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47f1 c.22.1.1 (F:1-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]} mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg lnvydivrterlvmdldawevfqnrigg
Timeline for d2v47f1: